Research Peptide
LL-37
PH-LL37-001≥99%HPLC Verified
Tap to zoomSpecifications
Catalog NumberPH-LL37-001
Purity (HPLC)≥99%
Molecular Weight4493.3 Da
SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Description
LL-37 is a high-purity (≥99%) human cathelicidin antimicrobial peptide with a molecular weight of 4493.3 Da. The 37-amino acid sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES is studied in immunology and host defense research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining antimicrobial activity, immune modulation, and wound healing pathways.
Documentation
COA
Certificate of AnalysisHPLC chromatogram, mass spectrometry, and batch documentation
Storage and Handling
- ❄️ Store lyophilized peptide at -20°C or below
- 🔒 Protect from light and moisture
- 🌡️ Allow vial to reach room temperature before opening
- 📦 Aliquot to avoid repeated freeze-thaw cycles
- 🔬 Handling and preparation are the responsibility of the research professional